DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and PRB1

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:150 Identity:31/150 - (20%)
Similarity:51/150 - (34%) Gaps:38/150 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKR----CDLQPTDHCISTEEFSS 133
            :|.||..|..:..|.|            :||..||..|.....:    |.|..:           
plant    34 VNAHNQARSQIGVGPM------------QWDEGLAAYARNYANQLKGDCRLVHS----------- 75

  Fly   134 PSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLG 198
               ...|.:..||........:.:|.|.::..:.:..:     :|.....||:.:::...|.|||
plant    76 ---RGPYGENLAKSGGDLSGVAAVNLWVNEKANYNYDT-----NTCNGVCGHYTQVVWRNSVRLG 132

  Fly   199 CAIASIEKGGWTHQWLACLY 218
            ||......||..   ::|.|
plant   133 CAKVRCNNGGTI---ISCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 30/149 (20%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.