DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and PRB1

DIOPT Version :10

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:150 Identity:31/150 - (20%)
Similarity:51/150 - (34%) Gaps:38/150 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKR----CDLQPTDHCISTEEFSS 133
            :|.||..|..:..|.|            :||..||..|.....:    |.|..:           
plant    34 VNAHNQARSQIGVGPM------------QWDEGLAAYARNYANQLKGDCRLVHS----------- 75

  Fly   134 PSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLG 198
               ...|.:..||........:.:|.|.::..:.:..:     :|.....||:.:::...|.|||
plant    76 ---RGPYGENLAKSGGDLSGVAAVNLWVNEKANYNYDT-----NTCNGVCGHYTQVVWRNSVRLG 132

  Fly   199 CAIASIEKGGWTHQWLACLY 218
            ||......||..   ::|.|
plant   133 CAKVRCNNGGTI---ISCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 CAP_euk 69..219 CDD:349399 30/149 (20%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 30/149 (20%)

Return to query results.
Submit another query.