DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CRISP2

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:247 Identity:55/247 - (22%)
Similarity:96/247 - (38%) Gaps:58/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PKCGKDP---KIIDVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILV 114
            |..||||   .::.....:::.|:|.||..|..|:       |.|:.|||::|..|:...|....
Human    18 PAEGKDPAFTALLTTQLQVQREIVNKHNELRKAVS-------PPASNMLKMEWSREVTTNAQRWA 75

  Fly   115 KRCDLQPTDHCISTEEFSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLID----- 174
            .:|.||.:|     .|....|.....|.:.:.:.|  ...|.:.:|||:        ::|     
Human    76 NKCTLQHSD-----PEDRKTSTRCGENLYMSSDPT--SWSSAIQSWYDE--------ILDFVYGV 125

  Fly   175 GLSTAKKEIGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYC 239
            |..:....:||:.:::...:.::||.||                .| |.::||.|.|..:   ||
Human   126 GPKSPNAVVGHYTQLVWYSTYQVGCGIA----------------YC-PNQDSLKYYYVCQ---YC 170

  Fly   240 TTGINGKFQNLCNDTEPV---KDCMHSELFQTITANDTTSLIRSMLNRQTQP 288
            ..     .:...|..|.:   |..:....||.:......:...:.:||:..|
Human   171 PA-----MKTYLNKREGINVWKCFLRLRHFQLLRGEQLLTFSGNNMNRKNTP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 34/154 (22%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 42/178 (24%)
Crisp 224..278 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.