DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:246 Identity:61/246 - (24%)
Similarity:96/246 - (39%) Gaps:64/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PKC-GKD----PKIIDVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATI 112
            ||. |||    |.|.| ||.| ...||.||..|..|.       |.||.|.:|.||.:||.||..
Mouse    23 PKAFGKDLPRVPTITD-PKFI-DAFLNIHNELRRKVQ-------PPAADMNQLFWDQQLAKLAKA 78

  Fly   113 LVKRCDLQPTDHCIS-----TEEFSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSL 172
            ..:.|.| ..:.||.     .|::.....:....:.:.:.:...|      .||::.|:.:..  
Mouse    79 WTRECKL-AHNPCIKQRYECLEDYDFIGENIYLGRIETQPEDVVI------NWYNESKYFNFD-- 134

  Fly   173 IDGLSTAKKEIGHFLRMIVGPSNRLGCAIASIEK-GGWTHQWLACLYSCSPQKNSLLYE-YSGKP 235
               .:|..:..||:.:::...:.::|||:::... .|::.....|.|  ||..|.:.:. |:   
Mouse   135 ---FNTCSEMCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLFVCNY--SPAGNFIGFRPYT--- 191

  Fly   236 GVYCTTGINGKFQNLCNDTEPVKDCMHSELFQTITANDTTSLIRSMLNRQT 286
                    .|...::|..    |.|             ..||.|.| ||:|
Mouse   192 --------RGDSCSMCGQ----KTC-------------ENSLCRPM-NRKT 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 34/155 (22%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 38/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841182
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.