DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and pi15b

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:289 Identity:64/289 - (22%)
Similarity:98/289 - (33%) Gaps:80/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LNLVFLLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKK---------LI 72
            |.|||:..:.:...::|....:    .|.|.:.|.| :.|.|..|...||..:|         .|
Zfish    10 LLLVFIASDASAWVIRNATETQ----TGTNLTFSTS-ELGDDQGIGSKPKSRRKRYISQSDMIAI 69

  Fly    73 LNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSYH 137
            |::||..|..|       .|.||.|..:.||..||..|......|..:           ..|.|.
Zfish    70 LDYHNKVRANV-------FPPAANMEYMLWDDGLARSAEAWAATCIWE-----------HGPPYL 116

  Fly   138 AVY--NKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIG-------------HFL 187
            ..|  .....:...:|.:...:..|||:.:        |.:....::..             |:.
Zfish   117 LRYLGQNLSVRTGNYRSILQLVKPWYDEVR--------DYMFPYPRDCNPHCPMRCYGPMCTHYT 173

  Fly   188 RMIVGPSNRLGCAIAS-IEKGGWTHQW-----LACLYSCSPQKNSLLYEYSGKPGVYCTT---GI 243
            :|:...|||:||||.: .....|...|     |.|.||   .|.:.:.|...:.||.|:.   ..
Zfish   174 QMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYS---PKGNWIGEAPYRVGVPCSACPPSY 235

  Fly   244 NGKFQNLCNDTEPVKDCMHSELFQTITAN 272
            .|             .|.::..|..|.:|
Zfish   236 GG-------------SCSNNMCFPAINSN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 38/179 (21%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 37/168 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.