DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and im:7150988

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002667823.1 Gene:im:7150988 / 504039 ZFINID:ZDB-GENE-050309-169 Length:150 Species:Danio rerio


Alignment Length:143 Identity:30/143 - (20%)
Similarity:54/143 - (37%) Gaps:39/143 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDL-----QPTDHCIST 128
            |:..|..||.||      ..|:.|                   .||.|.||     :..:|.:|.
Zfish     7 KQEFLQTHNQYR------HQHQAP-------------------PLVYREDLCRAAQKWAEHMLSK 46

  Fly   129 EEF---SSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMI 190
            :..   .:.:...||..|.:.:.| ...:..:::||.:.|..:.:.     |..:.:.|||.:::
Zfish    47 KSLGHSETENGENVYYSFSSVKKT-PTGKEAVDSWYSEIKDYNFAK-----SGHQPKTGHFTQVV 105

  Fly   191 VGPSNRLGCAIAS 203
            ...|..||..:|:
Zfish   106 WKSSKELGVGLAT 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 30/143 (21%)
im:7150988XP_002667823.1 SCP_GAPR-1_like 5..135 CDD:240182 30/143 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.