DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:282 Identity:66/282 - (23%)
Similarity:106/282 - (37%) Gaps:77/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVFLLPETNYCHLKNCPA--DKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILNHHNTYRD 81
            |:||.....|......|.  .|.||.:...|          ||:       .|...||.||..|.
  Rat     7 LIFLWTLALYLVASRLPKAFGKVLPRVPTIN----------DPE-------FKNGFLNSHNEARR 54

  Fly    82 IVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCIS-----TEEFSSPSYHAVYN 141
            .|.       |.|:.|.:|.||..||.||....:.|... .:.|.|     |:::.....:....
  Rat    55 KVQ-------PPASNMNQLSWDKSLAKLAKSWTRECKFS-HNPCTSKRHGCTKDYDYIGENIYLG 111

  Fly   142 KFKAK-EDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASI- 204
            |..|: ||.       :.:||::.|..:...     :|..|..||:.:::...:.::||||::. 
  Rat   112 KIDARPEDV-------VFSWYNETKDYNFDD-----NTCTKTCGHYTQVVWAKTLKIGCAISNCP 164

  Fly   205 EKGGWTHQWLACLYSCSPQKNSLLYEYSG-KPGVYCTTGINGKFQNLCNDTEPVKDCMHSELFQT 268
            ...|::.....|.|  .|..|     :.| ||  |    |.|:..::|.:    |:|::      
  Rat   165 HLTGYSAGLFVCNY--VPAGN-----FQGSKP--Y----IKGEPCSMCGE----KECVN------ 206

  Fly   269 ITANDTTSLIRSMLNRQTQPRT 290
                   ||....:.|.:|.:|
  Rat   207 -------SLCSHTMGRASQQKT 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 38/156 (24%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 39/169 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344589
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.