DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and crisp1.3

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001008204.1 Gene:crisp1.3 / 493566 XenbaseID:XB-GENE-951048 Length:240 Species:Xenopus tropicalis


Alignment Length:219 Identity:50/219 - (22%)
Similarity:82/219 - (37%) Gaps:44/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFS 132
            :.::|:|.||.||       .:..|.|..|||:.|:.:.|:.|......|           .|..
 Frog    34 VTQIIINAHNNYR-------RNASPSARNMLKMVWNKDAAINAASWAATC-----------SESH 80

  Fly   133 SPSYHAVYNKFKAKEDTFRIV-----RSQLNAWYDQYKH----VSSSSLIDGLSTAKKEIGHFLR 188
            |||.......|...|:.:...     ...:..||.:|..    |...|  .||.|     ||:.:
 Frog    81 SPSDKRTIPGFGCGENLYMASYPASWEEAVKGWYSEYNDFQYGVGPKS--PGLVT-----GHYTQ 138

  Fly   189 MIVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQKNSLL---YEYSGKPGVYCTTGI-NGKFQN 249
            ::...|..:||:::...|..:.: :..|.|..:...:|.:   |: :|.....|.|.. ||...|
 Frog   139 VMWYNSYMVGCSVSYCPKSPYKY-FYVCQYCPAGNLDSTMSTPYK-TGPKCADCPTACDNGLCTN 201

  Fly   250 LCNDTEPVKDC----MHSELFQTI 269
            .|...:...:|    .:...|.||
 Frog   202 YCPYQDLYSNCKTYASYCNTFPTI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 36/158 (23%)
crisp1.3NP_001008204.1 CAP_CRISP 33..170 CDD:349402 37/161 (23%)
Crisp 187..240 CDD:369954 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.