DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and glipr2l

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001005978.1 Gene:glipr2l / 449805 ZFINID:ZDB-GENE-041010-53 Length:154 Species:Danio rerio


Alignment Length:136 Identity:30/136 - (22%)
Similarity:54/136 - (39%) Gaps:31/136 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LNHHNTYRDIVAGGQMHRLP---IAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSP 134
            |..||.||      :.|:.|   :::::......:..:|.:|.::|........:|  .|..:..
Zfish    14 LKTHNEYR------RKHQAPPLKLSSKLCSEASRYAESLASTRILKHSVESSRGNC--GENLAWA 70

  Fly   135 SYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGC 199
            ||...     .|:.|.|        ||::....:.:.  .|.|:.   .|||..::...|.:||.
Zfish    71 SYDQT-----GKDVTDR--------WYNEVNQYNFNQ--PGFSSG---TGHFTAVVWKGSKKLGV 117

  Fly   200 --AIAS 203
              |:||
Zfish   118 GKAVAS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 30/136 (22%)
glipr2lNP_001005978.1 SCP_GAPR-1_like 9..139 CDD:240182 30/136 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.