DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and Ag5r

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:249 Identity:72/249 - (28%)
Similarity:125/249 - (50%) Gaps:11/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLFGLNLVF-LLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILNH 75
            :::|.|:|.| :...|:||. |:|.:.|.|   ||:|:|:|:..|..|..::.:....|..::..
  Fly     5 VIIFSLSLAFGIASATDYCK-KSCGSTKNL---GCDNNGAWASSCPSDATLLTLSSAEKDALVAR 65

  Fly    76 HNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSYHAVY 140
            .|.||:.:|||....|..|.||..:||:.|||.||::.||.|.:: .|.|.:|:.|.....:..:
  Fly    66 TNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMK-HDGCHNTDAFDWSGQNLAW 129

  Fly   141 NKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKK--EIGHFLRMIVGPSNRLGCAIAS 203
            ..:....:....:...::.|||:..: :..:.||...:...  .||||..::...:..:|||.|:
  Fly   130 MGYYNPLNVTHYLEWGVDMWYDEAVY-TKQAYIDAYPSNYNGPAIGHFTVLVADRNTEVGCAAAT 193

  Fly   204 IEKGGWTHQ--WLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDTE 255
            ....|.:::  .|||.|:.:......:|....|....||||.|.|::.||:..|
  Fly   194 YSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGTNPKYKYLCSAKE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 42/153 (27%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 42/153 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455072
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.