DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG42564

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:332 Identity:91/332 - (27%)
Similarity:143/332 - (43%) Gaps:49/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILNHHNTYRDIVAGGQ 87
            ||:  ||....|  .|:|.|:.||.|.....||..|.::|.:...:::.:|...|..||.||.|.
  Fly    52 LPD--YCDPSLC--HKELKHVACNASIELHDKCSLDAELIVISPKVERFLLRRFNELRDSVAKGG 112

  Fly    88 MHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFS-----SPSYHAVYNKFKAKE 147
            .:.|..|:||..|||:.|||.||...|:.|.|: .|.|.:| :|:     :..|..:..|....|
  Fly   113 FNGLSPASRMGTLKWNPELAYLAEFNVRDCVLR-HDECRNT-KFTQNAGQTVGYRGIKGKLPELE 175

  Fly   148 DTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIG----HFLRMIVGPSNRLGCAIASIEKGG 208
            |   |:|..:..|   .:..|.:|:::.:...::|..    :||::::..:..:||||....:.|
  Fly   176 D---ILRDIIGVW---LREKSRTSMVNIMKYVEQESQSPKYNFLQIVLENAESVGCAIVQQSRHG 234

  Fly   209 WTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDTEPVKDCMHSELFQTITAND 273
            |...:.||.|..:|...|.:||...|....|.||.|.|:.:||.:         ||:::.:|...
  Fly   235 WIQTFFACNYGHAPVVGSPVYEPGKKAAESCKTGANPKYAHLCAE---------SEVYEKVTPKA 290

  Fly   274 TTSLIRSMLNRQTQPRTFGWLWNWGKKIWGWVKNAWNAIVGCGKGGGGGGGDGGGGGGGDDGGEG 338
            ..:....:..|....|.|..|            |..||       .|....:||......||...
  Fly   291 GNASSPEIKTRTLGKRDFVML------------NGENA-------DGTPPAEGGAPAPAADGAAA 336

  Fly   339 DDGGDGG 345
            ....:||
  Fly   337 APAAEGG 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 46/158 (29%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 46/157 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455061
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.