DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG6628

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:264 Identity:80/264 - (30%)
Similarity:129/264 - (48%) Gaps:26/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLFG-LNLVF-----LLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKK 70
            |:||| |.:.|     ..|.|:||....||:.||  ||.|.|.|....:|..|..:::: ..::.
  Fly     9 LMLFGFLQVAFSQDNATAPPTDYCQSGLCPSLKK--HIACKNKGELGKQCSPDAHLVNL-TGLQD 70

  Fly    71 LILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPS 135
            |||..||..|:::|.|::..||...||..|:|..|||.|||:.||:|.|| .|.|.:|.:|.:..
  Fly    71 LILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQ-HDSCHNTPDFHNSG 134

  Fly   136 YH-AVYNKFKAKEDTFR----IVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLR----MIV 191
            .: |:.|.....||...    :|:..:..|::|..:::...|   ....|.::|..:|    |..
  Fly   135 QNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQL---QRFPKGKLGDSIRNFAVMAR 196

  Fly   192 GPSNRLGCAIASIEK-GGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDTE 255
            ..:..:|||....|| .|.....|||.|:.:...:..:|:   :..:.|.:|.:.|:.:||...|
  Fly   197 DNNTHVGCAALRFEKPAGHPLFLLACNYASNYVPDWPIYK---EKAIGCQSGSDLKYPSLCKAGE 258

  Fly   256 PVKD 259
            ..:|
  Fly   259 EYQD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 50/159 (31%)
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 50/159 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455073
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.