DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG34049

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:240 Identity:53/240 - (22%)
Similarity:81/240 - (33%) Gaps:98/240 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LKNCPAD-KKLPHIGCNNSGSWS----------PKC-------------GKDPK-------IIDV 64
            :|:.|.. ...|:...|....||          |||             .||.|       |..:
  Fly    73 IKSLPVKFPSTPNRSLNTEKDWSHGKRCLQCAAPKCKTSSRSSIQSKKLKKDKKSLLKEFEIYKI 137

  Fly    65 P----KHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHC 125
            |    |.||:.:|...|.||      ::|...      .||.|.:|                  |
  Fly   138 PIIRRKPIKQAVLRETNKYR------RLHNAN------PLKMDEKL------------------C 172

  Fly   126 ISTEEFSSPSYHAVYNKFKAK------EDTFRIVRSQ------LNAWY-DQYKHVSSSSLIDGLS 177
            ...:|::  .:.|..||.:.:      |:..|:.||:      |..|| ::|.:   ..|..|.:
  Fly   173 SYAQEWA--DHLADLNKLETRPNPLYGENIMRVRRSKFSVDQILKLWYQEKYNY---DYLKPGFN 232

  Fly   178 TAKKEIGHFLRMIVGPSNRLG----CAIASIEKGGWTHQWLACLY 218
            .   ..|||.:::...|..||    |.::||        |:.|.|
  Fly   233 L---YTGHFTQLVWRESEFLGVGVACDVSSI--------WIVCNY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 37/167 (22%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 37/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455030
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.