DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG43775

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster


Alignment Length:281 Identity:81/281 - (28%)
Similarity:124/281 - (44%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TGLLLLFGLNLVFLLPET---NYCHLKNCPAD-KKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIK 69
            |.:|||.|| |:.|||..   |||:.:....| .:..|..| ..|...|..|:......:|..:|
  Fly     2 TSILLLAGL-LLLLLPMVAGYNYCNNRTHVCDLAQRKHFMC-RLGELKPYGGRAKYYASIPDTLK 64

  Fly    70 --KLILNHHNTYRDIVAGGQM-----HRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCIS 127
              |..|...||:||::|||::     ...|.|.||..|:||.|||.:|...........:: |.|
  Fly    65 VRKDTLAVLNTFRDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSE-CRS 128

  Fly   128 TEEF---------SSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKE- 182
            |..|         |.|..|.:     :..:..|:|.:.:   :|:||.|...........:|:: 
  Fly   129 TLRFPLAGEVLALSPPVGHRL-----SLTELLRMVFAHI---FDEYKTVQDPQSFARRFDSKRDY 185

  Fly   183 -IGHFLRMIVGPSNRLGCAIA---SIEKG---GWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCT 240
             :|||..::....:|:||..|   :.||.   |:.| :|.|.:..:....|.:|: :||    .|
  Fly   186 SVGHFSIIVNDRVSRVGCGFAVGSNCEKDGKVGFCH-FLTCHFDYTNVNGSYVYK-TGK----AT 244

  Fly   241 TGING-------KFQNLCNDT 254
            ||.|.       |:.|||.:|
  Fly   245 TGCNDWKTIASIKYSNLCENT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 48/173 (28%)
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 47/171 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455069
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.