DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG17974

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:261 Identity:66/261 - (25%)
Similarity:119/261 - (45%) Gaps:17/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGPCVATGLL-LLFGLNLVFLLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPK 66
            |.|.:...:. |:|.|   .|..:.::|....|  ...:.||.|..:|::..:|..|...:||.:
  Fly     2 SSPLICLAIFQLIFQL---ILAKDYSWCDPDLC--GNGVRHIACRTTGNFHRRCQPDAVQVDVSR 61

  Fly    67 HIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEF 131
            | |...|:.||..|:.:|.|::.....||||..:.||.||..|:.:..:.|.|. .|.|.:|..:
  Fly    62 H-KADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLD-HDDCHNTYRY 124

  Fly   132 SSPSYH--AVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAK--KEIGHFLRMIVG 192
            ::...:  ||:.......:...:|...|..|::::..: .||.||......  ::.|||..:.|.
  Fly   125 ANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLI-DSSFIDSFKVTPIFEDYGHFAELSVD 188

  Fly   193 PSNRLGCAIASIEKGGWTHQWL---ACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDT 254
            .:..:||:|....:..:...::   .|.|:......:.:|| :|:....||||.:..:..||:..
  Fly   189 KNFAVGCSIMRFTRPDYPSVYIYNFICNYASLYALGAPVYE-TGRAASRCTTGKSHFYPGLCSTR 252

  Fly   255 E 255
            |
  Fly   253 E 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 38/156 (24%)
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 38/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455067
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.