DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG9822

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster


Alignment Length:252 Identity:72/252 - (28%)
Similarity:121/252 - (48%) Gaps:13/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLLLLFGLNLVFLLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILN 74
            |.||:. |.:....| .::|....|| |..: ||.|||.|.:...|..|..::|: |..:|||:|
  Fly    10 GCLLII-LGMASSQP-LSWCDPDLCP-DNTV-HIACNNDGKFHESCSPDATMVDL-KPYRKLIVN 69

  Fly    75 HHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSYH-- 137
            .||..|:.:|.|.:.....|.||..:.||.||..|||:.:|.|.|: .|.|.::..|.:...:  
  Fly    70 EHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLE-HDDCHNSYRFRNLGQNLC 133

  Fly   138 AVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLID-GLSTAKKEIGHFLRMIVGPSNRLGCAI 201
            .|..:.....:...:|...:..|:.::|.:.||.:.| .|:...::.|||:..::..:..:|||:
  Fly   134 GVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAM 198

  Fly   202 ASIEKGGWTHQWL---ACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDTE 255
            .......:...::   ||.|:........:|. :|||...|.||.|.::..||:..|
  Fly   199 MRFTNPQYPFLYIYNTACNYASVYAIGVPVYN-AGKPASECRTGSNPEYPALCSIKE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 41/155 (26%)
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 41/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455063
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.