DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and Crisp2

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001011710.1 Gene:Crisp2 / 360445 RGDID:621653 Length:243 Species:Rattus norvegicus


Alignment Length:236 Identity:50/236 - (21%)
Similarity:97/236 - (41%) Gaps:49/236 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PKCGKDPKIIDVPKH---IKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILV 114
            |..||||....:..:   :::.|:..||..|..|:       |..:.:||::|:.:.|..|....
  Rat    19 PTEGKDPDFATLTTNQIQVQREIIAKHNELRRQVS-------PPGSNILKMEWNVQAAANAQKWA 76

  Fly   115 KRCDLQPTDHCISTEEFSSPSYHAVYNKFKAKEDTFRIV-----RSQLNAWYDQYKHVSSSSLID 174
            ..|.|:.:    |||:...        ..|..|:.:...     |:.:.:||::     :.:.:.
  Rat    77 NNCILEHS----STEDRKI--------NIKCGENLYMSTDPTSWRTVIQSWYEE-----NENFVF 124

  Fly   175 GL-STAKKEIGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQKNSLLYE----YSGK 234
            |: :.....:||:.:::...|.::||.:|..........:..|.| | |..|:::.:    :.|.
  Rat   125 GVGAKPNSAVGHYTQLVWYSSFKVGCGVAYCPNQDTLKYFYVCHY-C-PMGNNVMKKSTPYHQGT 187

  Fly   235 PGVYCTTGI-NG------KFQNLCNDTEPVKD---CMHSEL 265
            |...|.... ||      .|::|.::.|.:|.   |.|..|
  Rat   188 PCASCPNNCDNGLCTNSCDFEDLLSNCESLKSSAGCKHELL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 29/155 (19%)
Crisp2NP_001011710.1 CAP_CRISP 36..172 CDD:349402 31/161 (19%)
Crisp 189..243 CDD:400739 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344587
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.