DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG10651

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:264 Identity:76/264 - (28%)
Similarity:129/264 - (48%) Gaps:17/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LNLVFLLPETNY-----CHLKNCPADK-KLPHIGCNNSGSWSPKCGKD-PKIIDVPKHIKKLILN 74
            :..::||..|.|     ...|.|.||. :..|:.|:::|::...|.|. ..::.:...:..||::
  Fly     2 IKCIWLLFSTLYIQDTGASDKWCKADLCRGQHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVD 66

  Fly    75 HHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQP-TDHCISTEEFSSPSYHA 138
            .||.||:..||| |.:.|.||||..::||.|||.:|..||:||  :| .|.|..|..:.......
  Fly    67 KHNEYRNKFAGG-MDQNPKAARMTTIEWDPELAKVADGLVRRC--EPIRDQCAITPNYGHAEVSY 128

  Fly   139 VYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIG-HFLRMIVGPSNRLGCAIA 202
            ...|:.........:|.||:.|:|.........|....:..::|:. ::.:::...:||:||||.
  Fly   129 SLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIV 193

  Fly   203 SIEKGGWTHQWLACLYSCS----PQKNSLLYEYSGKPGV-YCTTGINGKFQNLCNDTEPVKDCMH 262
            ...:....||.|.|:|:|.    .::::.:||.:.:... .|..|.|.:::|||:..|.||.|..
  Fly   194 EYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHKDELVKTCNG 258

  Fly   263 SELF 266
            ..||
  Fly   259 GSLF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 47/151 (31%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 47/151 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455077
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.