DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG16995

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_608668.2 Gene:CG16995 / 33413 FlyBaseID:FBgn0031412 Length:146 Species:Drosophila melanogaster


Alignment Length:164 Identity:38/164 - (23%)
Similarity:60/164 - (36%) Gaps:29/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSY 136
            :|..||.|| ...|.|...|......|..:|       |..|:.|..::...:    ..:....|
  Fly    10 VLQAHNLYR-AKHGAQPLTLSPKLNRLATEW-------ANYLLSRNRMEHRQN----SGYGENIY 62

  Fly   137 HAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAI 201
            .|.....|..:    .|||    ||::.:..:.:|     .:.:...|||.:::...|..||...
  Fly    63 MASGGNLKGAD----AVRS----WYEEIRQYNWNS-----PSFQGNTGHFTQVVWKSSTELGVGF 114

  Fly   202 ASIEKGGWTHQWLACLYSCSPQKNSLLYEYSGKP 235
            |   |.|.| .::.|.|:.....|:|..|....|
  Fly   115 A---KSGST-IYVVCNYNPPGNYNNLFRENVAPP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 33/146 (23%)
CG16995NP_608668.2 SCP_GAPR-1_like 5..125 CDD:240182 32/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455029
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.