powered by:
Protein Alignment CG34002 and CG4270
DIOPT Version :9
Sequence 1: | NP_001034029.2 |
Gene: | CG34002 / 3885644 |
FlyBaseID: | FBgn0054002 |
Length: | 350 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_608663.1 |
Gene: | CG4270 / 33408 |
FlyBaseID: | FBgn0031407 |
Length: | 170 |
Species: | Drosophila melanogaster |
Alignment Length: | 36 |
Identity: | 12/36 - (33%) |
Similarity: | 18/36 - (50%) |
Gaps: | 4/36 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 184 GHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYS 219
|||.::|...|..:|..:| .|...| |:.|.|:
Fly 122 GHFTQLIWKSSVEMGSGVA--RKADRT--WVVCNYN 153
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45455031 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.