DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG31296

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster


Alignment Length:260 Identity:58/260 - (22%)
Similarity:109/260 - (41%) Gaps:38/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILNHHNTYRDIVAGG-QMHR 90
            ::|.|..|..:    ::.|||...:|..|..:.:.:.:..: :.|:|...|.:|:..|.| |.:.
  Fly    24 DFCQLPYCGTN----NLACNNPSKFSVMCPPNARTLSMSTY-RNLLLIAFNEFRNYTASGKQKYL 83

  Fly    91 LPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEF-------SSPSYHAVYNKFKAKED 148
            ...||||.:|.:..||..||.:.|..|...  ..|::::||       .|..|....|.::..|.
  Fly    84 KAAAARMSRLSYSMELEDLARLAVITCSTH--KFCLNSQEFYYVGTNIGSTHYLGNLNDYEDLEL 146

  Fly   149 TFRIVRSQLNAW--YDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCA-----IASIEK 206
            ..||::.    |  |..|.::.....:. .:..|..|...|.::...:..:||:     :.|:  
  Fly   147 MLRIIQH----WTRYADYVNIKMGVYMP-TTLGKSGIAKALLLMADRNTHVGCSAMRFTVHSV-- 204

  Fly   207 GGWTHQWL-ACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLC---NDTEPVKDCMHSELFQ 267
                |.:: .|.:|........:|..|.:||..|.. ::..:..||   .:.|..|..:::.:||
  Fly   205 ----HNFVFLCAFSTDLFVERPIYRMSMRPGAACKR-LDPTYSALCAVGENYENNKPMLNARVFQ 264

  Fly   268  267
              Fly   265  264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 38/165 (23%)
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 38/165 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.