DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:252 Identity:56/252 - (22%)
Similarity:90/252 - (35%) Gaps:73/252 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLFGLNLVFLLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILNHH 76
            |.:.||.||             .....|:|.|             .||..||       ..:..|
Human    95 LWILGLCLV-------------ATTSSKIPSI-------------TDPHFID-------NCIEAH 126

  Fly    77 NTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSYHAVYN 141
            |.:|     |:::  |.||.|..:.||..||.:|.....:|..:..| |:      ..||.. |.
Human   127 NEWR-----GKVN--PPAADMKYMIWDKGLAKMAKAWANQCKFEHND-CL------DKSYKC-YA 176

  Fly   142 KFKAKEDTFRI-------VRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGC 199
            .|:...:...:       .|..:.|||::.:.....||     :..:..||:.:::...|..:||
Human   177 AFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSL-----SCSRVCGHYTQLVWANSFYVGC 236

  Fly   200 AIASIEK-GGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDTE 255
            |:|.... ||.:.....|.|  .|..|     ::..|..     :.|:..:||:..|
Human   237 AVAMCPNLGGASTAIFVCNY--GPAGN-----FANMPPY-----VRGESCSLCSKEE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 36/157 (23%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151115
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.