DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and antr

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster


Alignment Length:272 Identity:70/272 - (25%)
Similarity:123/272 - (45%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWSGPCVATGLLLLFGLNL-VFLLPETN-YCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIID 63
            ||        .|.||.|.| ..|:||.: :|....|...:  .|:||....:...:|||:...::
  Fly     3 MW--------YLYLFLLPLTASLIPEDDPHCKPNLCMNSE--IHVGCFQPKAVGEQCGKNNLFLN 57

  Fly    64 VPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCIST 128
            |...:|..||:..|..|:.||.| :....:||||..:.||.||..||...|::|| :....|.:|
  Fly    58 VNGALKTGILSRINMLRNYVASG-VGNYSVAARMPTMGWDFELQRLADRQVRQCD-ETGKFCANT 120

  Fly   129 EEFSSPSYHAVYNKFKAKEDTFRIVRSQL------NAWYDQYKHVSSSSLI----DGLSTAKKEI 183
            :::    ::....:.::|....:.::|.:      ..:.|....:.:|..:    :|..     :
  Fly   121 DKY----HYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTC-----V 176

  Fly   184 GHFLRMIVGPSNRLGCAI---ASIEKGGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGING 245
            ||::.:|....:|:||.:   ...||.  ::..|.|.:|.:...|.:.||....|...|.||.:.
  Fly   177 GHYMPLIQDHGSRMGCGLRVKGRDEKE--SNIILLCHFSRASVNNLVPYEEGQIPAGKCATGPSQ 239

  Fly   246 KFQNLCNDTEPV 257
            .:|.||::.|.|
  Fly   240 MYQFLCSEDEYV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 38/162 (23%)
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 38/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455060
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.