DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and D2062.1

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001293506.1 Gene:D2062.1 / 24104374 WormBaseID:WBGene00017055 Length:204 Species:Caenorhabditis elegans


Alignment Length:196 Identity:42/196 - (21%)
Similarity:73/196 - (37%) Gaps:71/196 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DVPKHIKKLILNHHNTYRD------IVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQP 121
            ::|| :|:||:.:||.||.      :||...|   .:||:    :|..|:|....|         
 Worm    43 NIPK-LKELIVAYHNLYRSKHGAPPLVADPVM---DVAAK----RWADEMAKSGWI--------- 90

  Fly   122 TDHCISTEEFSSPSYHAVYNKFKAKEDTF----------RIVRSQLNAWYDQYKHVSSSSLIDGL 176
                          .|....|:......|          .:.::.::.:|           |:|:
 Worm    91 --------------SHEKPRKYGENVAMFCQSGCWPLPQTLAQAMVHLFY-----------IEGI 130

  Fly   177 ----STAK----KEIGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSC---SPQKNSLLYE 230
                |:.|    ||.|||.:::...|.::|..| ||.|.. ...::..::.|   .|..|.|..:
 Worm   131 GYDYSSFKPELLKENGHFTQIVWKSSRKIGVGI-SIGKSS-QPPYIPTMFHCVKFDPPGNVLAQQ 193

  Fly   231 Y 231
            |
 Worm   194 Y 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 35/173 (20%)
D2062.1NP_001293506.1 CAP_GAPR1-like 46..189 CDD:349401 38/186 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161855
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.