DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and Crisp2

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:232 Identity:51/232 - (21%)
Similarity:99/232 - (42%) Gaps:42/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GKDP---KIIDVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRC 117
            ||||   .::.....:::.|:|.||..|..|.       |..:.:||::|..:....|.....:|
Mouse    22 GKDPDFTSLLTNQLQVQREIVNKHNELRRSVN-------PTGSDILKMEWSIQATTNAQKWANKC 79

  Fly   118 DLQPTDHCISTEEFSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGL-STAKK 181
            .|   :|  |:::....:.....|.:.:.:.|  :..:.:.:||::     :...:.|: :....
Mouse    80 IL---EH--SSKDDRKINIRCGENLYMSTDPT--LWSTVIQSWYNE-----NEDFVYGVGAKPNS 132

  Fly   182 EIGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQKNSLL-----YEYSGKPGVYCTT 241
            .:||:.:::...|.::||.||..........:..|.| | |..|:::     |: .|.|...|..
Mouse   133 AVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHY-C-PMGNNVMKKSTPYQ-QGTPCASCPN 194

  Fly   242 GI-NG------KFQNLCNDTEPVK---DCMHSELFQT 268
            .. ||      .|::|.::.|.:|   .|.| ||.:|
Mouse   195 NCENGLCTNSCDFEDLLSNCESLKTSAGCKH-ELLKT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 28/150 (19%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 30/155 (19%)
Crisp 189..243 CDD:285731 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841179
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.