DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and scl-14

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_502532.1 Gene:scl-14 / 184246 WormBaseID:WBGene00008625 Length:208 Species:Caenorhabditis elegans


Alignment Length:190 Identity:53/190 - (27%)
Similarity:75/190 - (39%) Gaps:38/190 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILNHHNTYRDIVAGGQ-------MHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDH--CIS 127
            |||.|||.|..:|.|.       .|   .|:.|||:||...||..:.|...||   ||.|  .|.
 Worm    27 ILNVHNTLRSRIAKGTYVARGTVKH---AASDMLKMKWLRSLATSSQIYANRC---PTGHSNMIG 85

  Fly   128 TEE-----FSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFL 187
            ..|     ::|.:...:        |.|..:.|.  ||..:::....||....:|.....:||..
 Worm    86 VGENLYWYWTSGTITNI--------DQFGAMASA--AWEKEFQDYGWSSNTLTMSLFNSGVGHAT 140

  Fly   188 RMIVGPSNRLGCAI--ASIEKGGWTHQWLACLYSCSPQKNSL---LYEYSGKPGVYCTTG 242
            :|....:|.:||.:  ..::..|.....:.|.|  .||.|.|   :|. ||.....|..|
 Worm   141 QMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHY--QPQGNYLNQNIYT-SGTTCSKCPAG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 43/162 (27%)
scl-14NP_502532.1 SCP 22..175 CDD:214553 44/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161793
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.