DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and scl-26

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_504963.1 Gene:scl-26 / 183662 WormBaseID:WBGene00016821 Length:208 Species:Caenorhabditis elegans


Alignment Length:190 Identity:41/190 - (21%)
Similarity:72/190 - (37%) Gaps:38/190 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HNTYRDIVAGG--QMHRLPIAARMLKLKWDHELALLATILVKRCD-LQPTDHCISTEEFSSPSYH 137
            ||..|:..:.|  ..|.:..:..|.||.|::.|...|...:..|| |:..:..:..         
 Worm    34 HNKLRNDASQGLWARHNISKSTDMQKLFWNNSLVAEAKHEMYDCDQLEKRELTLGE--------- 89

  Fly   138 AVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIV-GPSNRLGCAI 201
               |.::....|:..|..|      |.:...:....|.||:..:...:.||.|: ..||.:||..
 Worm    90 ---NIYQYDVTTYDDVDGQ------QGEAAINKDSHDALSSKDQAAQYRLRQILYSKSNSIGCIY 145

  Fly   202 ASIEK-----GGWTHQWLACLYSCSPQKNSL---LYEYSGKPGVYCTTGINGKFQNLCND 253
            .|.::     ..:..:::.|.|  ||...::   |||...:....|.:|.:      |.|
 Worm   146 ESCDRIDDEGTNYNTRFIICKY--SPALKNIDDQLYEEGEEACSNCPSGTS------CTD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 31/151 (21%)
scl-26NP_504963.1 CAP_euk 30..168 CDD:349399 32/153 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I4141
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.