DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and C07A4.2

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_509706.2 Gene:C07A4.2 / 182351 WormBaseID:WBGene00007397 Length:417 Species:Caenorhabditis elegans


Alignment Length:186 Identity:46/186 - (24%)
Similarity:74/186 - (39%) Gaps:43/186 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PAD---KKLPHIGCNNSGSWS-PKCGK-DPKIIDVPKHIKKLILNHHNTYRDIVAGGQMHRLP-- 92
            |.|   |:|.:||...|..:| .|..| ||...|:|| :|:.::::||.||      ..|..|  
 Worm   215 PLDTDVKRLSNIGAIKSYLFSKSKVDKQDPARYDIPK-LKEWLVSYHNVYR------SKHGAPAL 272

  Fly    93 IAARMLK---LKWDHELALLATILVKRCDLQPTDH-----CISTEEFSSPSYHAVYNKFKAKEDT 149
            |:..:|.   .:|..|||.....||..   ||..:     ........||...|.     |...:
 Worm   273 ISDSVLDSRGKRWADELAYHKGCLVHE---QPRTYGENLFFFGARHLPSPQTLAA-----AVIQS 329

  Fly   150 FRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASIE 205
            |.:.....|  |..::.:|..           :.|||.::|...|.::|..::.::
 Worm   330 FYLEGIGYN--YSSWRPMSFF-----------KTGHFTQLIWKNSRKIGVGVSIVK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 31/147 (21%)
C07A4.2NP_509706.2 CAP_GAPR1-like 251..402 CDD:349401 32/150 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161854
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.