DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and vap-2

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:258 Identity:61/258 - (23%)
Similarity:103/258 - (39%) Gaps:60/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CHLKNC---PADKKL--------PHIGCNNSGSWSPKCGKDPKII-DVPKHIKKLILNHHNTYRD 81
            |..|:|   |..|.|        |.:..::.||:  :|  |..:: ||.::   ..|..||.||.
 Worm   271 CEDKDCFTYPGSKCLVPEGLCQAPSMVKDDGGSF--QC--DNSLVSDVTRN---FTLEQHNFYRS 328

  Fly    82 IVA------GGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSY-HAV 139
            .:|      |......|.|::|:|:::|..|...|......|....:.|      :..|:. ..:
 Worm   329 RLAKGFEWNGETNTSQPKASQMIKMEYDCMLERFAQNWANNCVFAHSAH------YERPNQGQNL 387

  Fly   140 YNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAK------KEIGHFLRMIVGPSNRLG 198
            |....:..|...::.:.:..|:.:.:...:.  ||.:.|.:      |.|||:.:|....:.|||
 Worm   388 YMSSFSNPDPRSLIHTAVEKWWQELEEFGTP--IDNVLTPELWDLKGKAIGHYTQMAWDRTYRLG 450

  Fly   199 CAIASIEKGGWTHQWLACLYS-CSPQKNSLLYEYSGKP---------GVYCTTGINGKFQNLC 251
            |.||:..|    ..::.|.|. ...:||:.:||. |.|         |..|.     |..:||
 Worm   451 CGIANCPK----MSYVVCHYGPAGNRKNNKIYEI-GDPCEVDDDCPIGTDCE-----KTTSLC 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 36/162 (22%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553
SCP 315..468 CDD:214553 37/167 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.