DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and lon-1

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:241 Identity:53/241 - (21%)
Similarity:87/241 - (36%) Gaps:74/241 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEE 130
            :::||.|.:.||.||.:|....|:         .|.|..|||..|......||.:.:...|:..|
 Worm    78 EYLKKWITHEHNRYRRMVPASDMN---------MLYWSDELAASAQRHADTCDFRHSRGRINVGE 133

  Fly   131 --FSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQ-----------YKHVSSSSLIDGLSTAKKE 182
              :::|     |:.:.          ..::.|:::           |||.               
 Worm   134 NIWAAP-----YSNYS----------DAISIWFNEVHNPRCGCNHAYKHC--------------- 168

  Fly   183 IGHFLRMIVGPSNRLGCAIASIE--KGGW---THQWLACLYSCSPQKNSLLYEYSGK----PGVY 238
            .||:::::...:|.:||..:...  :|.|   ......|.|  :||.|::.....|:    |...
 Worm   169 CGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFVCHY--NPQGNTVFVTARGQLYAMPAFT 231

  Fly   239 CTTGINGKFQNLCNDTEPVKDCMHS--------ELFQTITANDTTS 276
            ..:|.|||..| |....|.  |...        |...|.|.:.|||
 Worm   232 WASGDNGKCSN-CPANAPA--CYQGLCYMPKNYEAPTTTTESTTTS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 33/167 (20%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 34/170 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.