DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and Crispld2

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:280 Identity:65/280 - (23%)
Similarity:99/280 - (35%) Gaps:89/280 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VATGLLLLFGLNLVFLLPET--------NYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIID 63
            |..||.||......|.||.|        .|.|.:        ||.....:               
  Rat     9 VPVGLALLVCGVQAFFLPNTMSLERLLSKYQHTE--------PHSRVRRA--------------- 50

  Fly    64 VPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRC--DLQPTDHCI 126
            :|...::.||..||..|     ||::  |.|:.|..:.||.||...|....:||  :..|....:
  Rat    51 IPMSDRQEILMLHNKLR-----GQVY--PPASNMEYMTWDEELERSAAAWAQRCLWEHGPASLLV 108

  Fly   127 STEE--------FSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQ-------YKHVSSSSLIDGL 176
            |..:        :.||.:|                   :.:|||:       |.|..:....:..
  Rat   109 SIGQNLAVHWGRYRSPGFH-------------------VQSWYDEVKDYTYPYPHECNPWCPERC 154

  Fly   177 STAKKEIGHFLRMIVGPSNRLGCAIASIEK-GGWTHQW-----LACLYSCSPQKN---SLLYEYS 232
            |.|.  ..|:.:|:...:|::|||:.:... ..|...|     |.|.|  ||:.|   ...|:: 
  Rat   155 SGAM--CTHYTQMVWATTNKIGCAVHTCRSMSVWGDIWENAVYLVCNY--SPKGNWIGEAPYKH- 214

  Fly   233 GKPGVYCTTGINGKFQ-NLC 251
            |:|...|.:...|..: |||
  Rat   215 GRPCSECPSSYGGGCRNNLC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 39/172 (23%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 40/174 (23%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344581
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.