DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CRISP1

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:255 Identity:64/255 - (25%)
Similarity:104/255 - (40%) Gaps:64/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SWSPKCGKDP--KII-DVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLAT 111
            |...|..:|.  |:: |:| ::::.|:|.||..|..|       :|.|:.|||:.|..|.|..|.
Human    20 SMKKKSARDQFNKLVTDLP-NVQEEIVNIHNALRRRV-------VPPASNMLKMSWSEEAAQNAR 76

  Fly   112 ILVKRCDLQ---------PTDHCISTEEFSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQ---Y 164
            |..|.||:.         |...|  .|.....||...::             |.:..||.:   :
Human    77 IFSKYCDMTESNPLERRLPNTFC--GENMHMTSYPVSWS-------------SVIGVWYSESTSF 126

  Fly   165 KHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSC----SPQKN 225
            ||...::..|.::|     .|:.:::...|..:||||||..:.|.......|.| |    .|:..
Human   127 KHGEWTTTDDDITT-----DHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHY-CHEGNDPETK 185

  Fly   226 SLLYEYSGKPGVYCTTGINGKFQNLCNDTEPVKDCM-HSELFQT------ITANDTTSLI 278
            :..|: :|.|...|.:....|   ||  |.|   |: :.|.|..      :..|.:|:::
Human   186 NEPYK-TGVPCEACPSNCEDK---LC--TNP---CIYYDEYFDCDIQVHYLGCNHSTTIL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 41/161 (25%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 42/165 (25%)
Crisp 195..249 CDD:285731 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151111
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.