DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG43776

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster


Alignment Length:269 Identity:67/269 - (24%)
Similarity:112/269 - (41%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLFGLNLVFLLPETNYCHLKN-----CPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLI 72
            :.:|.|  :....|:.|.|.|     |..| |:|.:|.....:..|         |:|| ::..|
  Fly    16 MTYGYN--YCNNRTHRCILLNTQHFMCRLD-KIPSLGGTRYHAIVP---------DIPK-LRTEI 67

  Fly    73 LNHHNTYRDIVAGG-----QMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFS 132
            |...|.:|:..|.|     :......|.||.::.||.|||.:|.........|.| .|.||..|.
  Fly    68 LRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHT-KCRSTVRFP 131

  Fly   133 S---------PSY-HAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSS-SSLIDGLSTAKKEI-GH 185
            .         |.| |.|:   :|.:..|:|:       :|::.|:.. ..|:.|....:..: .|
  Fly   132 RVGECLAMMVPKYKHTVH---EALKKMFKIM-------FDEHLHIQDPRGLLQGFHPIRDYVSSH 186

  Fly   186 FLRMIVGPSNRLGCAIA---SIEKGGWTH--QWLACLYSCSPQKNSLLYEYSGKPGVYCT---TG 242
            |..::....:|:||.:|   :..:|..::  .:|.|.:.......|.:|: :|||...|:   |.
  Fly   187 FTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYDNVNGSYVYK-AGKPASSCSDWGTT 250

  Fly   243 INGKFQNLC 251
            .:.:|.|||
  Fly   251 KSKEFANLC 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 41/171 (24%)
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 41/171 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455068
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.