DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and R3HDML

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_848586.1 Gene:R3HDML / 140902 HGNCID:16249 Length:253 Species:Homo sapiens


Alignment Length:230 Identity:54/230 - (23%)
Similarity:78/230 - (33%) Gaps:75/230 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IDVPKHIKK---------LILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRC 117
            ::||::.:|         .:|::||..|..|       .|.||.|..:.||..||..|.....:|
Human    47 LEVPRYRRKRHISVRDMNALLDYHNHIRASV-------YPPAANMEYMVWDKRLARAAEAWATQC 104

  Fly   118 DLQPTDHCISTEEFSSPSYHAVY--NKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAK 180
            ...           ..||....|  .........:|.|...:.:|.::..|.        |..|.
Human   105 IWA-----------HGPSQLMRYVGQNLSIHSGQYRSVVDLMKSWSEEKWHY--------LFPAP 150

  Fly   181 KE-------------IGHFLRMIVGPSNRLGCAI---ASIEKGGWTHQW-----LACLYSC---- 220
            ::             ..|:.:|:...||||||||   :||..  |.:.|     |.|.|:.    
Human   151 RDCNPHCPWRCDGPTCSHYTQMVWASSNRLGCAIHTCSSISV--WGNTWHRAAYLVCNYAIKGNW 213

  Fly   221 ---SPQKNSLLYEYSGKPGVYCTTGINGKF-QNLC 251
               ||.|       .|||...|.....|.. .|:|
Human   214 IGESPYK-------MGKPCSSCPPSYQGSCNSNMC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 41/181 (23%)
R3HDMLNP_848586.1 SCP 65..207 CDD:320774 40/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151103
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.