DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and Crisp3

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:218 Identity:45/218 - (20%)
Similarity:84/218 - (38%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KIIDVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDH 124
            |:....|.:::.|::.||..|..|:       |..:.:|.::|:::..:.|.        |..|.
Mouse    30 KLSTSKKSVQEEIVSKHNQLRRKVS-------PSGSDLLNMEWNYDAQVNAQ--------QRADK 79

  Fly   125 CISTEEFSSPSYHAVYNKFKAKEDTFR---IV--RSQLNAWYDQYKHVSSSSLIDGLSTAK--KE 182
            |    .||...........|..|:.|.   :|  .|.:..||::     |..||.|:...:  ..
Mouse    80 C----TFSHSPIELRTTNLKCGENLFMSSYLVPWSSVIQGWYNE-----SKGLIFGVGPKQNVSV 135

  Fly   183 IGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQKNSLLYEYSG----KPGV-YCTTG 242
            :||..:::...:.::.|.:|...:....: :..|.| | |..|     |||    :|.: |....
Mouse   136 VGHHTQVVWKSNLQVACGVAECPENPLRY-FYVCRY-C-PVLN-----YSGHYPSRPYLAYTARA 192

  Fly   243 INGKFQNLCNDTEPVKDCMHSEL 265
            ......:.|.|....|.|.:.::
Mouse   193 PCASCPDRCEDGLCTKSCQYKDM 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 30/156 (19%)
Crisp3NP_033769.1 SCP 37..172 CDD:294090 32/161 (20%)
Crisp 194..241 CDD:285731 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841189
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.