DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and GLIPR1

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_006842.2 Gene:GLIPR1 / 11010 HGNCID:17001 Length:266 Species:Homo sapiens


Alignment Length:248 Identity:54/248 - (21%)
Similarity:79/248 - (31%) Gaps:79/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILNHHNTYRDIVAGGQMHR 90
            :||.|..|...|                        |:....||..: ..||.:|..|.      
Human    16 SNYSHTANILPD------------------------IENEDFIKDCV-RIHNKFRSEVK------ 49

  Fly    91 LPIAARMLKLKWDHELALLATILVKRCD------LQPTDHCISTEEFSSPSYHAVYNKFKAKEDT 149
             |.|:.||.:.||..||.:|......|.      |:|.              |.::..|.:..:.
Human    50 -PTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPP--------------HKLHPNFTSLGEN 99

  Fly   150 FRI-------VRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASIEK- 206
            ...       |.|.:..|||:.:.....:.|     .||..||:.:::...|.::|||:....| 
Human   100 IWTGSVPIFSVSSAITNWYDEIQDYDFKTRI-----CKKVCGHYTQVVWADSYKVGCAVQFCPKV 159

  Fly   207 ------GGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGK--FQNLC 251
                  ....|  ..|.|  .|..|...:.|  |.|..|:...|..  ..|||
Human   160 SGFDALSNGAH--FICNY--GPGGNYPTWPY--KRGATCSACPNNDKCLDNLC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 36/169 (21%)
GLIPR1NP_006842.2 SCP_GLIPR-1_like 32..178 CDD:240185 38/176 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151109
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.