DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CRISP3

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001355052.1 Gene:CRISP3 / 10321 HGNCID:16904 Length:276 Species:Homo sapiens


Alignment Length:300 Identity:64/300 - (21%)
Similarity:105/300 - (35%) Gaps:75/300 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PCVATGL----LLLFGLNLVFLLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDP---KII 62
            || :||.    :.||.: |:||:...    |.:.||::                 .|||   .::
Human    22 PC-STGFVFPAMTLFPV-LLFLVAGL----LPSFPANE-----------------DKDPAFTALL 63

  Fly    63 DVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQ---PTDH 124
            .....:::.|:|.||..|..|:       |.|..|||::|:.|.|..|.....:|:.:   |.|.
Human    64 TTQTQVQREIVNKHNELRRAVS-------PPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDR 121

  Fly   125 CISTEEFSSPSYHAVYNKFKAKEDTFRIVRSQ-----LNAWYDQYKHVSSSSLIDGLSTAKKEIG 184
            ..|               .|..|:.:....|.     :.:|:|:|.......   |..|....:|
Human   122 MTS---------------LKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGV---GPKTPNAVVG 168

  Fly   185 HFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQK--NSLLYEY-SGKPGVYCTTGINGK 246
            |:.:::...|..:||..|..........:..|.| |....  |.|...| .|.|...|...    
Human   169 HYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQY-CPAGNWANRLYVPYEQGAPCASCPDN---- 228

  Fly   247 FQNLCNDTEPVKDCMHSELFQTITANDTTSLIRSMLNRQT 286
                |:|......|.:.:|:....:...|...:..|.|.:
Human   229 ----CDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 34/157 (22%)
CRISP3NP_001355052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151119
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.