DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG42764

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster


Alignment Length:132 Identity:26/132 - (19%)
Similarity:40/132 - (30%) Gaps:56/132 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 AKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASIEKGGW 209
            |||...::.:|..:.:          |.|...||.:..:|.      .|.:|       .:||| 
  Fly   119 AKERRTKVEQSLADKF----------SAITWKSTTEMGVGW------APKDR-------SKKGG- 159

  Fly   210 THQWLACLYSCSPQKNSLLYEYS---GKPGVYCTTGINGKFQNLCNDTEPVKDCMHSELFQTITA 271
                          :..|:..||   .:||.|               .|.:.|....|.|:..|.
  Fly   160 --------------RKILVVRYSPAGNQPGEY---------------AENIGDTEFLEYFKMPTR 195

  Fly   272 ND 273
            .|
  Fly   196 ED 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 14/73 (19%)
CG42764NP_001189140.1 SCP 22..172 CDD:294090 17/90 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.