DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CG42780

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster


Alignment Length:247 Identity:69/247 - (27%)
Similarity:104/247 - (42%) Gaps:12/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFGLNLVFLLPETNYCHLKNCPADKKLPHIGCNN-SGSWSPKCGKDPKIIDVPKHIKKLILNHHN 77
            :|.|:||......|:|....|  .|...||.|.| :||:...|.||..:|.:....|..::..||
  Fly     8 IFVLSLVLHSLAENFCRQDLC--TKGTTHIACQNVNGSFGSSCPKDATVIKLNLGDKNALIKAHN 70

  Fly    78 TYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSY------ 136
            ..|...|.|:......|.:|.|::|:.:|..||.:..|.| |...|.|.:||:|.....      
  Fly    71 LVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTC-LMGHDECHNTEKFRLSGQNLFAMG 134

  Fly   137 --HAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGC 199
              ||...|.|.......:....:..|..:.|.:::..|........:.|||...:|...||.:||
  Fly   135 FSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGC 199

  Fly   200 AIASIEKGGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLC 251
            .:.:...|......|||.|:.:......:||...|.|:.|..||:.|:..||
  Fly   200 GLVAYNLGEIRRYNLACNYAYTNVIGERVYEECAKAGIECAKGIDQKYPPLC 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 40/157 (25%)
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455071
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.