DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and LOC100497187

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_017945658.1 Gene:LOC100497187 / 100497187 -ID:- Length:208 Species:Xenopus tropicalis


Alignment Length:198 Identity:43/198 - (21%)
Similarity:70/198 - (35%) Gaps:55/198 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLFGLNLVFLLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKKLILNHH 76
            |.||||   ||| .|.:   ..|.|              :..:.|.|..:....      .|..|
 Frog    38 LSLFGL---FLL-STEF---STCSA--------------FPSRRGADENLFQTQ------FLEAH 75

  Fly    77 NTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTE--EFSSPSYHAV 139
            |.||      :.|.:|      .::.:.||:..|...        .:|.:|..  :.|......:
 Frog    76 NKYR------KKHNVP------PMRLNAELSKSAQTW--------ANHLLSINKMQHSGAGGENL 120

  Fly   140 YNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASI 204
            |..:.::..|. .....::|||::.|....:.  .|...|   .|||.:::...|..||..:|:.
 Frog   121 YYSYSSRGRTL-AGNVAVDAWYNEVKDYDYNK--PGFKAA---TGHFTQVVWKDSKELGVGVATD 179

  Fly   205 EKG 207
            .||
 Frog   180 GKG 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 30/141 (21%)
LOC100497187XP_017945658.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.