DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and crisp2-like

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001188271.2 Gene:crisp2-like / 100495843 -ID:- Length:207 Species:Xenopus tropicalis


Alignment Length:202 Identity:46/202 - (22%)
Similarity:79/202 - (39%) Gaps:44/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HNTYRDIVAGG-------------QMHRL------PIAARMLKLKWDHELALLATILVKRCDLQP 121
            |:||.|  .||             .:|.|      |.|..|||::|....||.|.....:|.:| 
 Frog    18 HSTYGD--DGGTPMLDTETQNYLVDLHNLLRRSVDPTAKDMLKMEWSPGAALNAQNAAAKCVMQ- 79

  Fly   122 TDHCISTEEFSSPSYHAVYNK----FKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLS-TAKK 181
              |..:||......::.|..:    ..||.|.    .:.:|:|:::     .:....|:. .:.|
 Frog    80 --HSSATERQIQDPFNYVCGENIYVTTAKPDW----AAAVNSWFNE-----RNDFTYGVGPNSDK 133

  Fly   182 EIGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSC--SPQKNSLLYEYSGKPGVYCTTGIN 244
            .|||:.::....:..|||.:|...  |..:.:::..:.|  ....||:...|  :.|.:|.:...
 Frog   134 MIGHYTQVAWAKTYLLGCGLAFCP--GNYYPYVSICHYCPMGNMINSIKTPY--EAGEWCASCPE 194

  Fly   245 GKFQNLC 251
            .....||
 Frog   195 SCEDKLC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 38/166 (23%)
crisp2-likeNP_001188271.2 SCP 33..171 CDD:320774 32/151 (21%)
Crisp 189..>205 CDD:312162 3/13 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.