DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and r3hdml

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:302 Identity:66/302 - (21%)
Similarity:100/302 - (33%) Gaps:92/302 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWSGPCV-------ATGLLLLFGLNLVFLLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKD 58
            :|..|.:       ||.||.|...|      :|.:......|..::..:|.              
 Frog    15 LWITPLLSAFLLDRATELLSLSNRN------QTEHMFGSGIPRIRRKRYIS-------------- 59

  Fly    59 PKIIDVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTD 123
                  |:.:..| |::||..|..|       .|.||.|..:.||..||..|.....:|   ..|
 Frog    60 ------PRDMSAL-LDYHNQVRSKV-------FPPAANMEYMVWDERLAKSAESWANQC---KWD 107

  Fly   124 HCISTEEFSSPSYHAVY--NKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLID-GLSTAKKEIG- 184
            |        .|:....|  .........:|.:...:..|||:.:|.|.....: ..|...|..| 
 Frog   108 H--------GPNQLMRYIGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGA 164

  Fly   185 ---HFLRMIVGPSNRLGCAI---ASIEKGGWTHQ---WLACLYSC-------SPQKNSLLYEYSG 233
               |:.:|:...|||:|||:   .:|...|.|.:   :|.|.||.       :|.|       .|
 Frog   165 VCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYK-------LG 222

  Fly   234 KPGVYCTTGINGKFQNLCNDTEPVKDCMHSELFQTITANDTT 275
            :|...|.....|.             |.::..|..:.:|..|
 Frog   223 RPCSACPPSYGGV-------------CSNNMCFSGVKSNKLT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 42/162 (26%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 42/163 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.