DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and pi15

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:242 Identity:56/242 - (23%)
Similarity:81/242 - (33%) Gaps:75/242 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VPKHIKK---------LILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDL 119
            |||..:|         .|:.:||..|..|       .|.||.|..:.||..||.||......|  
 Frog    53 VPKARRKRYISQNDMIAIVEYHNQVRGKV-------FPPAANMEYMVWDENLAKLAEAWAATC-- 108

  Fly   120 QPTDHCISTEEFSSPSYHAVY--NKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKE 182
             ..||        .|||...:  .....:...::.:...:..|||:.|        |......:|
 Frog   109 -IWDH--------GPSYLLKFLGQNLSVRTGRYKSILQLVKPWYDEVK--------DYAFPYPQE 156

  Fly   183 IG-------------HFLRMIVGPSNRLGCAIASIEK-GGWTHQW-----LACLYSCSPQKNSLL 228
            ..             |:.:|:...:||:||||.:... ..|...|     |.|.||   .|.:.:
 Frog   157 CNPRCPLRCYGPMCTHYTQMVWATTNRIGCAIHTCHNMNVWGAVWRRAVYLVCNYS---PKGNWI 218

  Fly   229 YE--YS-GKPGVYCTTGINGKFQNLCNDTEPVKDCMHSELFQTITAN 272
            .|  |: |.|...|.....|             .|..::.|..:|:|
 Frog   219 GEAPYTIGVPCSACPPSYGG-------------SCSDNQCFPGVTSN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 40/179 (22%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 39/170 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.