DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and R3hdml

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:279 Identity:72/279 - (25%)
Similarity:103/279 - (36%) Gaps:84/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TGLLLLFGLNLVFL-LPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKK-- 70
            |||||..|..:..| :|.|..  ::..|          .|:..| |..|     :.||:|.:|  
Mouse    11 TGLLLWMGHTVGALRMPNTTL--VQGRP----------KNTAVW-PLSG-----LGVPRHRRKRH 57

  Fly    71 -------LILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCIST 128
                   .:|::||..|     ..:|  |.||.|..:.||.:||..|.....:        ||.|
Mouse    58 ISARDMSALLDYHNHIR-----ASVH--PPAANMEYMVWDEQLARSAEAWATQ--------CIWT 107

  Fly   129 EEFSSPSYHAVY--NKFKAKEDTFRIVRSQLNAWYDQYKHVSSSS----------LIDGLSTAKK 181
            .   .||....|  .........||.|...:.:|.::.:|.|..:          |..|     .
Mouse   108 H---GPSQLMKYVGQNLSIHSGRFRSVVDLVRSWSEEKRHYSFPAPKDCTPHCPWLCSG-----P 164

  Fly   182 EIGHFLRMIVGPSNRLGCAI---ASIEKGGWTHQ---WLACLYSC-------SPQKNSLLYEYSG 233
            ...|:.:|:...|:||||||   :||...|.|.|   :|.|.|:.       :|.|       :|
Mouse   165 VCSHYTQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPYK-------AG 222

  Fly   234 KPGVYCTTGINGKF-QNLC 251
            ||...|.....|.. .|:|
Mouse   223 KPCSACPPSYQGNCNSNMC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 45/176 (26%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 44/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841169
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.