DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34039 and Commd4

DIOPT Version :9

Sequence 1:NP_001034012.2 Gene:CG34039 / 3885643 FlyBaseID:FBgn0054039 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_079693.1 Gene:Commd4 / 66199 MGIID:1913449 Length:199 Species:Mus musculus


Alignment Length:208 Identity:68/208 - (32%)
Similarity:108/208 - (51%) Gaps:32/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFRFCGEGDCPDWVLAEIISTLSNLSIENLEQLSDLVAQRICGETFEEAKIKSLTSTLTNEG-- 63
            |:|||||:.||||||||| ||||:.:|...|..|...|.:.:.|:..:..||..||:....|.  
Mouse     1 MRFRFCGDLDCPDWVLAE-ISTLAKISSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGD 64

  Fly    64 -KTAVACINFMLTSAARYSCSESIFGEEIQQLGLPKDHAAAMCRVLQKHSATIRQTLINKSFRIN 127
             |..||.::|:|:|||::|........|:|||||||:||.::||..::..:.:::.|...|.|:|
Mouse    65 VKATVAVLSFILSSAAKHSVDSDSLSSELQQLGLPKEHATSLCRCYEEKQSPLQEHLRACSLRVN 129

  Fly   128 ELTSVRDISTPGQTPPNYATLELKISQELVDGLPKDTTHV----------------LNIDRTQMK 176
            .|.||.            ..::..:|..|:..:.:...|:                :::...:.:
Mouse   130 RLASVG------------WRVDYTLSSSLLHSVEEPMVHLQLQVVPAPGTQAQPVSMSLSADKFQ 182

  Fly   177 ALLAELKLARDVM 189
            .||||||.|:.:|
Mouse   183 VLLAELKQAQTMM 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34039NP_001034012.2 HCaRG 23..190 CDD:284632 50/186 (27%)
Commd4NP_079693.1 Commd4 25..198 CDD:240100 49/183 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842060
Domainoid 1 1.000 99 1.000 Domainoid score I7137
eggNOG 1 0.900 - - E1_28K8D
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9865
Inparanoid 1 1.050 106 1.000 Inparanoid score I4912
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54538
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007165
OrthoInspector 1 1.000 - - oto92131
orthoMCL 1 0.900 - - OOG6_105743
Panther 1 1.100 - - LDO PTHR16231
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3436
SonicParanoid 1 1.000 - - X5270
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.