DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34039 and commd4

DIOPT Version :9

Sequence 1:NP_001034012.2 Gene:CG34039 / 3885643 FlyBaseID:FBgn0054039 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001011118.1 Gene:commd4 / 496531 XenbaseID:XB-GENE-974195 Length:197 Species:Xenopus tropicalis


Alignment Length:206 Identity:67/206 - (32%)
Similarity:113/206 - (54%) Gaps:30/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFRFCGEGDCPDWVLAEIISTLSNLSIENLEQLSDLVAQRICGETFEEAKIKSLTSTLTNEG-- 63
            |:|||||:.||||||||| |||||.:|...|:.:...|.:::.||..:..||..|||....|.  
 Frog     1 MRFRFCGDLDCPDWVLAE-ISTLSRISSVKLKLICAQVLKKLLGEQIDYEKIIKLTSDARFESGD 64

  Fly    64 -KTAVACINFMLTSAARYSCSESIFGEEIQQLGLPKDHAAAMCRVLQKHSATIRQTLINKSFRIN 127
             |..||.:.|:|:|||:::.|......|:||||||::|||::||..::....:::||...|.|:.
 Frog    65 IKATVAVLCFILSSAAKHNVSSDSLSSELQQLGLPREHAASLCRSYEEKQNALQETLRESSLRLT 129

  Fly   128 ELTSVRDISTPGQTPPNYATLELKISQELVDGLPKDTTHV--------------LNIDRTQMKAL 178
            .::|:           |:...:: :|..:|..:.:...|:              :.:..::::.|
 Frog   130 RISSL-----------NWRVDQI-LSSSIVKQVNEPLVHLNLNVTDAGCNQPLTMTVSASKLRVL 182

  Fly   179 LAELKLARDVM 189
            :.|||.|.::|
 Frog   183 ITELKQALEMM 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34039NP_001034012.2 HCaRG 23..190 CDD:284632 49/184 (27%)
commd4NP_001011118.1 Commd4 25..196 CDD:240100 47/181 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6816
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9865
Inparanoid 1 1.050 106 1.000 Inparanoid score I4793
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505629at2759
OrthoFinder 1 1.000 - - FOG0007165
OrthoInspector 1 1.000 - - oto102441
Panther 1 1.100 - - LDO PTHR16231
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3436
SonicParanoid 1 1.000 - - X5270
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.