DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34039 and T28F2.2

DIOPT Version :9

Sequence 1:NP_001034012.2 Gene:CG34039 / 3885643 FlyBaseID:FBgn0054039 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001368503.1 Gene:T28F2.2 / 189048 WormBaseID:WBGene00020901 Length:183 Species:Caenorhabditis elegans


Alignment Length:183 Identity:49/183 - (26%)
Similarity:86/183 - (46%) Gaps:27/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFRFCGEGDCPDWVLAEIISTLSNLSIENLEQL----SDLVAQRICGETFEEAKIKSLTS---T 58
            ||:.|.|:.:||.|:|.||.:..|||::...::|    |.||   :||   .:..|.|.||   .
 Worm     1 MKYHFLGDMECPSWLLEEICTNFSNLTVLKFKELCNRASHLV---LCG---HDKPILSDTSEGIN 59

  Fly    59 LTNEGKTAVACINFMLTSAARYSCSESIFGEEIQQLGLPKDHAAAMCRVLQKHSATIRQTLINKS 123
            ..|.....|...|::|...|.|.|..:...:|:.|||||.:|...:.:|.:.:.:.:|:.:.:..
 Worm    60 SVNNHTNLVLIGNWLLLKPAGYDCPSTDLEKEVVQLGLPPEHGIQLRKVYENYKSELREKVCSSV 124

  Fly   124 FRINELTSVRDISTPGQTPPNYATL-------ELKISQELVDGLPKDTTHVLN 169
            :|....|.: |.|      |:..|.       ::.:|..:::.|..|..:.|:
 Worm   125 YREPHATII-DAS------PSSITFQADTQMYDVSMSGSMMNQLKNDVENALS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34039NP_001034012.2 HCaRG 23..190 CDD:284632 39/161 (24%)
T28F2.2NP_001368503.1 Commd <79..>118 CDD:414734 11/38 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162243
Domainoid 1 1.000 66 1.000 Domainoid score I6611
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3939
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505629at2759
OrthoFinder 1 1.000 - - FOG0007165
OrthoInspector 1 1.000 - - oto18545
orthoMCL 1 0.900 - - OOG6_105743
Panther 1 1.100 - - LDO PTHR16231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5270
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.