DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34039 and LOC112268145

DIOPT Version :9

Sequence 1:NP_001034012.2 Gene:CG34039 / 3885643 FlyBaseID:FBgn0054039 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_024305882.1 Gene:LOC112268145 / 112268145 -ID:- Length:388 Species:Homo sapiens


Alignment Length:192 Identity:65/192 - (33%)
Similarity:98/192 - (51%) Gaps:33/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFRFCGEGDCPDWVLAEIISTLSNLSIENLEQLSDLVAQRICGETFEEAKIKSLTSTLTNEG--- 63
            :|||||:.||||.|||| ||||:.:|...|:.|...|.:.:.|:..:..||..||:....|.   
Human   111 RFRFCGDLDCPDRVLAE-ISTLAKMSSVKLQLLCSQVLKELLGQGIDYKKILKLTADAKFESGDV 174

  Fly    64 KTAVACINFMLTSAARYSCSESIFGEEIQQLGLPKDHAAAMC-------RVLQKHSAT-----IR 116
            |..||.::|:|:.||::|........|:|||||||:|||:.|       ..||||...     ::
Human   175 KATVAVLSFILSGAAKHSVDGKSLASELQQLGLPKEHAASPCCCYEEKQSPLQKHLRVCSLRKVQ 239

  Fly   117 QTLINKS------------FRINELTSVRDISTPGQTPPNY----ATLELKISQELVDGLPK 162
            :.|:..:            ||:..|.:|.......:|.|.:    |::..:.||||: ||.:
Human   240 RNLVPAAVNPYVMIFLPALFRVLVLAAVFGQVVGSKTIPGFHHRQASMVSRWSQELL-GLSR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34039NP_001034012.2 HCaRG 23..190 CDD:284632 49/171 (29%)
LOC112268145XP_024305882.1 Commd 134..>236 CDD:323413 34/101 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.