DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and SEC14L5

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens


Alignment Length:351 Identity:71/351 - (20%)
Similarity:131/351 - (37%) Gaps:88/351 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSPELQKTAIENLNEVPNKLDDD----------------IAALRDWIKQQPHLKARTDDQFLVNF 55
            |.|.|:..:::.     :|||.|                :..||.|: |:.|......|:.::.|
Human   212 LGPALEAVSMDG-----DKLDADYIERCLGHLTPMQESCLIQLRHWL-QETHKGKIPKDEHILRF 270

  Fly    56 LRGCKFSLERTKSKIDRFYTLRTKY---------------PEFYLG--HNVDVD-KALEIFRLGT 102
            ||...|.|::.:..:.:..:.|.::               .|||.|  |..|:| :.|.|.|||.
Human   271 LRAHDFHLDKAREMLRQSLSWRKQHQVDLLLQTWQPPALLEEFYAGGWHYQDIDGRPLYILRLGQ 335

  Fly   103 IVILPRPLNDNGPRLALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVNGL-------IS 160
            :                       .:|..::.|...|.|...:.::|:......|.       ||
Human   336 M-----------------------DTKGLMKAVGEEALLRHVLSVNEEGQKRCEGSTRQLGRPIS 377

  Fly   161 ----ILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKK 221
                :|||..:...|..:.......:|....|:..|.....:..:..|..|..::.:|.|.:::.
Human   378 SWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLISPFINEN 442

  Fly   222 QQGRLYVH-GSKWE---ALYNQIPKQYLPVEYGGEN-------GSIPELLQQWEQRILAYRNYWE 275
            .:.:..:: ||.::   .|.:.:.::.:|...|||:       |.:|:.|...|:........|:
Human   443 TRRKFLIYSGSNYQGPGGLVDYLDREVIPDFLGGESVCNVPEGGLVPKSLYMTEEEQEHTDQLWQ 507

  Fly   276 EEKNYGTDESLRVGQP--VDFESLFG 299
            ..:.|.:...|| |.|  |..|.|.|
Human   508 WSETYHSASVLR-GAPHEVAVEILEG 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 11/41 (27%)
SEC14 96..252 CDD:238099 28/170 (16%)
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214 1/1 (100%)
CRAL_TRIO_N 243..288 CDD:215024 11/45 (24%)
SEC14 306..479 CDD:214706 38/195 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.