DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and SEC14

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:261 Identity:60/261 - (22%)
Similarity:107/261 - (40%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PNKLDD----DIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKSKIDRFYTLRTK---- 79
            |..||.    .:|.||..::....:: |.||..|:.|||..||.::..|...:.....|..    
Yeast    26 PGNLDSAQEKALAELRKLLEDAGFIE-RLDDSTLLRFLRARKFDVQLAKEMFENCEKWRKDYGTD 89

  Fly    80 -----------------YPEFYLGHNVDVD-KALEIFRLGTIVILPRPLNDNGPRLALLRMACYD 126
                             ||::|  |..|.| :.:....||.:.:  ..:|.......:|:...::
Yeast    90 TILQDFHYDEKPLIAKFYPQYY--HKTDKDGRPVYFEELGAVNL--HEMNKVTSEERMLKNLVWE 150

  Fly   127 PS---KYTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQE 188
            ..   :|.|...:||||            .:|....:|:||..::......:. |:.::.:...:
Yeast   151 YESVVQYRLPACSRAAG------------HLVETSCTIMDLKGISISSAYSVM-SYVREASYISQ 202

  Fly   189 EALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWE-ALYNQIPKQYLPVEYGGE 252
            ...|.|....:.||.|.||.|.|.:.||.:......::::.||.:: .|..|||.:.|||::||:
Yeast   203 NYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYQKELLKQIPAENLPVKFGGK 267

  Fly   253 N 253
            :
Yeast   268 S 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 13/41 (32%)
SEC14 96..252 CDD:238099 36/159 (23%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 13/45 (29%)
SEC14 99..269 CDD:214706 43/187 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.