DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33966 and YKL091C

DIOPT Version :9

Sequence 1:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_012832.1 Gene:YKL091C / 853771 SGDID:S000001574 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:247 Identity:61/247 - (24%)
Similarity:101/247 - (40%) Gaps:55/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QPHLKARTDDQFLVNFLRGCKFSL--------------------------ERTKSKIDR-FYTLR 77
            :.:.|.|.||..|:.|||..||.:                          |..|...|: ...|.
Yeast    42 EKNYKERLDDSTLLRFLRARKFDINASVEMFVETERWREEYGANTIIEDYENNKEAEDKERIKLA 106

  Fly    78 TKYPEFYLGHNVDVD-KALEIFRLGTIVILPRPLNDNGPRLALLRMACYDP---SKYTLQEVNRA 138
            ..||::|  |:||.| :.|....||.|.:  :.:........:||....:.   :.|.:...:|.
Yeast   107 KMYPQYY--HHVDKDGRPLYFEELGGINL--KKMYKITTEKQMLRNLVKEYELFATYRVPACSRR 167

  Fly   139 AGLMQQIMLDEDDVAIVNGLISILDLSNVTTG---HFLQMSPSFAKKMTVFQEEALPLRPQGIHF 200
            ||.            ::....::|||..::..   |.|    |:.|.:....:...|.|....:.
Yeast   168 AGY------------LIETSCTVLDLKGISLSNAYHVL----SYIKDVADISQNYYPERMGKFYI 216

  Fly   201 INTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKW-EALYNQIPKQYLPVEYGG 251
            |::|.||.|:|.|:||.:......::::.||.: :.|..|||.:.|||:|||
Yeast   217 IHSPFGFSTMFKMVKPFLDPVTVSKIFILGSSYKKELLKQIPIENLPVKYGG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 12/57 (21%)
SEC14 96..252 CDD:238099 39/163 (24%)
YKL091CNP_012832.1 CRAL_TRIO_N 30..75 CDD:215024 10/32 (31%)
SEC14 101..271 CDD:214706 48/188 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.